Protein Info for CCNA_03588 in Caulobacter crescentus NA1000

Annotation: two-component sensor histidine kinase PhyK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 567 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 255 to 273 (19 residues), see Phobius details amino acids 279 to 297 (19 residues), see Phobius details PF07536: HWE_HK" amino acids 368 to 420 (53 residues), 27.7 bits, see alignment 5.8e-10 PF07568: HisKA_2" amino acids 368 to 441 (74 residues), 92.1 bits, see alignment E=2.8e-30 PF02518: HATPase_c" amino acids 477 to 560 (84 residues), 29.4 bits, see alignment E=1.4e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_03588)

Predicted SEED Role

"sensor histidine kinase, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CDH4 at UniProt or InterPro

Protein Sequence (567 amino acids)

>CCNA_03588 two-component sensor histidine kinase PhyK (Caulobacter crescentus NA1000)
MTVFTGRAARAVTSIRVRLAMALCVALLPVLILGGLQSIFAFRAEADARRQSLELAAGHS
ATIARARIEAAGVLLQTLGPGSVGLECAQRLADVRARLPGYANLIRFDARGRVSCAAATT
PYDPQRGARPWFQALRASEDMVVASAPGVVYADEPAVLAAVRAGTPERFDGAMAAVLTLR
ELKLQTTNRFMPEGAEVALADSNGRVFAATRPSAFGAPQLDWRQIAARDKSVMWSGADLE
GHSRNYSAAPLVDDHVFVILSAPSSGLLSWASINPISRLLLPLLAFFLALGAVLYAAERG
VIRWIVYLQRVAAIYARGRFTVRPLQAERAPPEIRELAATLDAMAGGIVARDASLMDSLA
EKDALMREIHHRVKNNLQIITSLLNMQQRALSDPAAKAAMNDTRQRITALAQIYRALYQG
PDLKRVDLRPFLEELTAQLLASDMGGFGGGGLVRTEVHADPLVIDPDRLAPIALFAVEAI
TNAQKHAFGPSGGTLVVGFHVRGEEAELSISDDGPGAVESLGGGVGRTLMTAFARQLRGQ
VAFETREPRGLTVRLTFPTPQALSAAG