Protein Info for CCNA_03534 in Caulobacter crescentus NA1000

Annotation: 4-hydroxybenzoate polyprenyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 transmembrane" amino acids 41 to 59 (19 residues), see Phobius details amino acids 67 to 90 (24 residues), see Phobius details amino acids 117 to 153 (37 residues), see Phobius details amino acids 164 to 182 (19 residues), see Phobius details amino acids 188 to 210 (23 residues), see Phobius details amino acids 231 to 253 (23 residues), see Phobius details amino acids 259 to 278 (20 residues), see Phobius details amino acids 290 to 309 (20 residues), see Phobius details TIGR01474: 4-hydroxybenzoate polyprenyl transferase" amino acids 28 to 308 (281 residues), 371.5 bits, see alignment E=1.5e-115 PF01040: UbiA" amino acids 54 to 290 (237 residues), 208.2 bits, see alignment E=6.7e-66

Best Hits

KEGG orthology group: K03179, 4-hydroxybenzoate octaprenyltransferase [EC: 2.5.1.-] (inferred from 100% identity to ccs:CCNA_03534)

Predicted SEED Role

"4-hydroxybenzoate polyprenyltransferase (EC 2.5.1.39)" (EC 2.5.1.39)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-

Use Curated BLAST to search for 2.5.1.- or 2.5.1.39

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CBU3 at UniProt or InterPro

Protein Sequence (315 amino acids)

>CCNA_03534 4-hydroxybenzoate polyprenyltransferase (Caulobacter crescentus NA1000)
MTAAQSPPGVLPDAAATNWVDRHAPQRLRPWLKLGRFDRPVGIWLLMLPGWQGIALAAAE
QGRWPNPLLLLAVFVGAALMRAAGCAFNDIVDRDFDAQVARTAMRPIPAGLISVKQAWLF
VVGCCGVSFLILICLGWTAILLGVLSLALVAAYPFMKRITWWPQAWLGLTFNWGALLGYA
AATGHLSWSAALLYASGIFWTLGYDTIYAIQDIEDDALAGIKSSTRRLGQHVQIGVAGFY
LVSFILLVIAGWMGDIGPLFLPLAALFALHLSRQAAAVRIEDGPGALKLFKSNALAGLLV
FAGLVAGLWKPGVSF