Protein Info for CCNA_03524 in Caulobacter crescentus NA1000

Annotation: di-/tripeptide transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 626 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 44 to 62 (19 residues), see Phobius details amino acids 70 to 89 (20 residues), see Phobius details amino acids 98 to 115 (18 residues), see Phobius details amino acids 193 to 214 (22 residues), see Phobius details amino acids 237 to 257 (21 residues), see Phobius details amino acids 263 to 283 (21 residues), see Phobius details amino acids 311 to 328 (18 residues), see Phobius details amino acids 334 to 353 (20 residues), see Phobius details amino acids 365 to 382 (18 residues), see Phobius details amino acids 447 to 466 (20 residues), see Phobius details amino acids 476 to 495 (20 residues), see Phobius details amino acids 505 to 524 (20 residues), see Phobius details amino acids 538 to 559 (22 residues), see Phobius details amino acids 584 to 606 (23 residues), see Phobius details PF00854: PTR2" amino acids 97 to 399 (303 residues), 144.2 bits, see alignment E=2.7e-46 amino acids 440 to 570 (131 residues), 61.5 bits, see alignment E=3.5e-21 TIGR00924: amino acid/peptide transporter (Peptide:H+ symporter)" amino acids 193 to 399 (207 residues), 132.2 bits, see alignment E=1.4e-42

Best Hits

KEGG orthology group: K03305, proton-dependent oligopeptide transporter, POT family (inferred from 100% identity to ccs:CCNA_03524)

Predicted SEED Role

"Di-/tripeptide transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CBT4 at UniProt or InterPro

Protein Sequence (626 amino acids)

>CCNA_03524 di-/tripeptide transporter (Caulobacter crescentus NA1000)
MNIVIAVGILVTLVTGIPVLLQLLKGHPRGLIICFLAEMWERFSYYGMRAILIFYLTQHF
LFDPKAASGHYGSYTALVYLVPLIGGFLADKWLGTRKAVAFGAVLLVAGHLAMAIEGKPA
VQTLTYQGATYEFQAEGRGQNREAKLVVDGKAYEVAATKVGDFEIKGLPANAPLPAVLPK
ADYKLDVAGRDPLYLNIFWFSLSLIILGVGFLKPNISTIVGQLYPQGDPRRDPGFTLYYY
GINLGSFWASILCGLLGVNVGWWAGFGLAGVGMLAGFIVFVLGKPWLDGKAEPPEPKVLK
EKVAGPINRELAIYGLSLVGLVGIFFLVQFNAIVGVALNIGILASLGYIGFFMFTKCAKE
ERERLALAVFLIFGAVVFWTLFEQAGSSLSLFAATNVQLDLVREPLRLFSGAVTLATPDQ
LAKAGIDAASTFWVDTSFNAPQTQALNAGWILIFAPVFAAVWTFLGARGKDPNPVIKFGL
ALIQVGAGFLLLQWGSTFADGAFKLPLIFLVLMYMLHTTGELCMSPVGLSQMTKLSPASV
VSFMMAVWFLAVAIAQWVGGKIAGLAATETVGGQVLDPGAALAASLKVFNIIGLVAVAIG
IGFLLLSPVLKKWSHGADNVGAPKKA