Protein Info for CCNA_03516 in Caulobacter crescentus NA1000

Annotation: protoheme IX farnesyltransferase coxE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 transmembrane" amino acids 37 to 54 (18 residues), see Phobius details amino acids 60 to 82 (23 residues), see Phobius details amino acids 105 to 124 (20 residues), see Phobius details amino acids 130 to 150 (21 residues), see Phobius details amino acids 157 to 176 (20 residues), see Phobius details amino acids 182 to 207 (26 residues), see Phobius details amino acids 231 to 248 (18 residues), see Phobius details amino acids 254 to 274 (21 residues), see Phobius details amino acids 309 to 330 (22 residues), see Phobius details TIGR01473: protoheme IX farnesyltransferase" amino acids 28 to 325 (298 residues), 324.9 bits, see alignment E=2.9e-101 PF01040: UbiA" amino acids 42 to 283 (242 residues), 206.3 bits, see alignment E=2.5e-65

Best Hits

Swiss-Prot: 100% identical to COXX_CAUVC: Protoheme IX farnesyltransferase (ctaB) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K02301, protoheme IX farnesyltransferase [EC: 2.5.1.-] (inferred from 100% identity to ccs:CCNA_03516)

Predicted SEED Role

"Cytochrome c oxidase polypeptide I (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1, 2.5.1.-

Use Curated BLAST to search for 1.9.3.1 or 2.5.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CDA3 at UniProt or InterPro

Protein Sequence (339 amino acids)

>CCNA_03516 protoheme IX farnesyltransferase coxE (Caulobacter crescentus NA1000)
MSKTAAMTSDSAETTPLRDSSETARWQDYFQLMKPRVMSLVVFTGLTGLLAARAPIHPVL
AAIAVLCIAVGAGASGALNMWYDADIDQKMRRTRGRPVPAGKIKGEEAASLGVVLSLLSV
MFLGFAVNWLAAGLLAFTIVFYAVVYTMWLKRWTAQNIVIGGLAGALPPAIGWAAATGSA
PLNAWLMVAIIFFWTPPHFWALSLYVTTDYAKAGVPMLPVVKGARETRKQILLYSLILFP
ICLSPVLTGLGGPIYLAVSGLGGLVFLLLAWRVFASKAGDAADPRVADRALYDVTEDEKA
AGAKAARNLFAFSILYLFALFAALLGEAVTGVRPLELLK