Protein Info for CCNA_03513 in Caulobacter crescentus NA1000

Annotation: cytochrome c oxidase subunit III coxC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 transmembrane" amino acids 17 to 36 (20 residues), see Phobius details amino acids 48 to 67 (20 residues), see Phobius details amino acids 87 to 109 (23 residues), see Phobius details amino acids 178 to 197 (20 residues), see Phobius details amino acids 221 to 245 (25 residues), see Phobius details amino acids 265 to 286 (22 residues), see Phobius details PF00510: COX3" amino acids 7 to 283 (277 residues), 260.6 bits, see alignment E=1.1e-81

Best Hits

KEGG orthology group: K02276, cytochrome c oxidase subunit III [EC: 1.9.3.1] (inferred from 100% identity to ccr:CC_3402)

Predicted SEED Role

"Cytochrome c oxidase polypeptide III (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CF49 at UniProt or InterPro

Protein Sequence (290 amino acids)

>CCNA_03513 cytochrome c oxidase subunit III coxC (Caulobacter crescentus NA1000)
MAGAVKHDYHILPPSPWPFVGSAAATVMAIGLIGWLKGGVLGIEKGNWAIFAAGMAGILY
TMFGWWADVAKESKAGDHTPVVSIGLRYGMILFIASEVMFFVAWFWMFFEMALFHEHRTL
STIEEVRTAWAAWPPAGVETVSAWHLPLINTLTLLLSGTTVTWAHHALQVGDRKGAKWGL
ILTIVLGCLFTAIQVYEYAHINHEQLFYSEAAANSGLYGSTFFLATGFHGFHVFVGTLFL
IVCLIRLMTGAFTPQKHFGFEAAAWYWHFVDVVWLFLFAFIYVIFGASAH