Protein Info for CCNA_03512 in Caulobacter crescentus NA1000

Annotation: zinc-finger protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 120 transmembrane" amino acids 50 to 71 (22 residues), see Phobius details amino acids 77 to 96 (20 residues), see Phobius details PF06170: DUF983" amino acids 24 to 107 (84 residues), 102.6 bits, see alignment E=5.9e-34

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_03512)

Predicted SEED Role

"conserved hypothetical protein in cyt c oxidase gene clusters"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CDH3 at UniProt or InterPro

Protein Sequence (120 amino acids)

>CCNA_03512 zinc-finger protein (Caulobacter crescentus NA1000)
MTKVNPYAAGARGLCPHCGEGYLFDGFLKVAPRCEACGFELGKHETGDGAATFVILIAGA
ICAFGALFSMFAWNWPVWVSLVVWLPAVVAISLGLMRPAKGLMVAAQIAQKASEAGRDHV