Protein Info for CCNA_03508 in Caulobacter crescentus NA1000

Annotation: ribosomal-protein-S5-alanine acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 PF13302: Acetyltransf_3" amino acids 21 to 164 (144 residues), 85.8 bits, see alignment E=6.7e-28 PF13420: Acetyltransf_4" amino acids 26 to 183 (158 residues), 29.4 bits, see alignment E=1.1e-10 PF00583: Acetyltransf_1" amino acids 46 to 164 (119 residues), 44.6 bits, see alignment E=2.4e-15

Best Hits

KEGG orthology group: K03790, ribosomal-protein-alanine N-acetyltransferase [EC: 2.3.1.128] (inferred from 100% identity to ccr:CC_3397)

Predicted SEED Role

"Ribosomal-protein-S5p-alanine acetyltransferase" in subsystem Ribosomal protein S5p acylation or Ribosome biogenesis bacterial

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.128

Use Curated BLAST to search for 2.3.1.128

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CF45 at UniProt or InterPro

Protein Sequence (192 amino acids)

>CCNA_03508 ribosomal-protein-S5-alanine acetyltransferase (Caulobacter crescentus NA1000)
MSVLLPFLSPRPRLRLQGRAVYLRPPMQRDYAPWAALRSRSRAFLEPWEPTWPEHDLSRA
AFRARLAAYARELELGEAYPFFIFRREDDALLGAIRLFHVRRGVSLTGTIGYWLGEPYVR
QGHMADAVETLIRFAFHGLGLHRLEAACMPENHASAALLAKCGFSEEGYAHAYLKINGAW
RDHRLFGLVAPE