Protein Info for CCNA_03501 in Caulobacter crescentus NA1000

Annotation: SUA5 translation factor-related protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 TIGR00057: tRNA threonylcarbamoyl adenosine modification protein, Sua5/YciO/YrdC/YwlC family" amino acids 19 to 215 (197 residues), 169.9 bits, see alignment E=2e-54 PF01300: Sua5_yciO_yrdC" amino acids 28 to 205 (178 residues), 183.1 bits, see alignment E=3.7e-58 PF03481: Sua5_C" amino acids 207 to 322 (116 residues), 82 bits, see alignment E=6.3e-27

Best Hits

KEGG orthology group: K07566, putative translation factor (inferred from 100% identity to ccs:CCNA_03501)

Predicted SEED Role

"TsaC protein (YrdC-Sua5 domains) required for threonylcarbamoyladenosine t(6)A37 modification in tRNA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CDG1 at UniProt or InterPro

Protein Sequence (325 amino acids)

>CCNA_03501 SUA5 translation factor-related protein (Caulobacter crescentus NA1000)
MGFDGRDRGAGEGQLQADRQAEVAAAAEALRAGGLVILPTETVYGLGANAADPAAVAAIF
EAKGRPRFNPLIAHVADLETAARIAVFDDRAHALAREFWPGPLTIVAPIRDPEAVCDLAR
AGLDTVAIRVPGHPLSRAVLAAFGGAVVAPSANRSGRPSPTTYDDAMAETGDKAAAHLDG
GPCAVGLESTVVSVLEGEVRLLRPGAVTRVQLQQIVGRLAEAQDDAKRSPGRLALHYAPD
APVRINAKTPEAGEAYLAFGPWPESPRVFNLSPTGDLAEAAANLFAFLRAADRIRPSAIA
VAPIPEEGLGEAINDRLRRAAGYVG