Protein Info for CCNA_03495 in Caulobacter crescentus NA1000

Annotation: D-beta-hydroxybutyrate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 TIGR01963: 3-hydroxybutyrate dehydrogenase" amino acids 10 to 265 (256 residues), 403.7 bits, see alignment E=1.3e-125 PF00106: adh_short" amino acids 10 to 204 (195 residues), 197.8 bits, see alignment E=2.6e-62 PF08659: KR" amino acids 12 to 165 (154 residues), 45.4 bits, see alignment E=1.8e-15 PF13561: adh_short_C2" amino acids 18 to 262 (245 residues), 182 bits, see alignment E=2.8e-57

Best Hits

Swiss-Prot: 60% identical to BDHA_RHIME: D-beta-hydroxybutyrate dehydrogenase (bdhA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00019, 3-hydroxybutyrate dehydrogenase [EC: 1.1.1.30] (inferred from 100% identity to ccs:CCNA_03495)

MetaCyc: 36% identical to 2-(R)-hydroxypropyl-CoM dehydrogenase subunit (Xanthobacter autotrophicus Py2)
2-(R)-hydroxypropyl-CoM dehydrogenase. [EC: 1.1.1.268]

Predicted SEED Role

"D-beta-hydroxybutyrate dehydrogenase (EC 1.1.1.30)" in subsystem Polyhydroxybutyrate metabolism (EC 1.1.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.268 or 1.1.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CDF4 at UniProt or InterPro

Protein Sequence (265 amino acids)

>CCNA_03495 D-beta-hydroxybutyrate dehydrogenase (Caulobacter crescentus NA1000)
MAVDFGLQGQVAIVTGSTSGIGHAMADALAAQGCNIVMNGLGEMNAIERARAEMAETHGV
EVLYHGADMTRPIEIADMVRAAKAEFGELDILVNNAGVQHVAPVEDFPEDKWDLIIAVNL
SSAFHATKAAVPIMKEQGRGRIVNIASAHGLVASPFKSAYVAAKHGIMGLTKTVALEVAQ
HGITCNAICPGFVKTPLVEAQIADQAKARGISEEAVMRDVILASQPTKQFVTFDQLNGML
LYLVSDLGASANGAAYQIDGGWVAQ