Protein Info for CCNA_03492 in Caulobacter crescentus NA1000

Annotation: M50-like Site-2 protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 transmembrane" amino acids 14 to 32 (19 residues), see Phobius details amino acids 39 to 58 (20 residues), see Phobius details amino acids 91 to 115 (25 residues), see Phobius details amino acids 127 to 151 (25 residues), see Phobius details amino acids 158 to 179 (22 residues), see Phobius details amino acids 207 to 231 (25 residues), see Phobius details

Best Hits

Swiss-Prot: 39% identical to RIP2_MYCTU: Putative zinc metalloprotease Rip2 (rip2) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_03492)

Predicted SEED Role

"Sterol-regulatory element binding protein (SREBP) site 2 protease family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CBQ8 at UniProt or InterPro

Protein Sequence (255 amino acids)

>CCNA_03492 M50-like Site-2 protease (Caulobacter crescentus NA1000)
MTILEAPARPHAPISPNALILIAAVIGLGWAVATEVQPLGVITFAFVAAAWVLSVGIHEF
GHAFTAYKAGDTTIVEKGYLTLDPLKYSDLFTTIIIPLVALALGGIGFPGGAVYLREDLM
RSRGWRSLASLAGPLGTLVVLVVIAVSLPLAAASPPLFNALSLLAMLQASALVLNLLPVP
GLDGYGVIRPFLPEGVQARMMKVERVGFLILFALIFWAPGVSEFIFAAALTITDLLGVSR
PAIGDGWRTFHFWGS