Protein Info for CCNA_03483 in Caulobacter crescentus NA1000

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 PF00005: ABC_tran" amino acids 27 to 169 (143 residues), 122.6 bits, see alignment E=3.9e-39

Best Hits

KEGG orthology group: K01990, ABC-2 type transport system ATP-binding protein (inferred from 100% identity to ccr:CC_3373)

Predicted SEED Role

"ABC-type multidrug transport system, ATPase component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CCD9 at UniProt or InterPro

Protein Sequence (314 amino acids)

>CCNA_03483 ABC transporter ATP-binding protein (Caulobacter crescentus NA1000)
MVRGDGVTSIISVQGLTKTYASGHQALKRIDLDIRQGEIFALLGPNGAGKTTLISIICGI
VNPSQGVILADGHDVVRDYRAARTKIGLVPQELHTDAFETVWATVSFSRGLFGKPRNDAL
IEQILRDLSLWDKKDSKIMALSGGMKRRVMIAKALSHEPTILFLDEPTAGVDVELRRDMW
EMVRKLRESGVTIILTTHYIEEAEEMADRIGVINKGEIILVEDKTVLMRKLGKKQLTVHL
KAPLAALPAALADASLSLANDGADLVYTFDAQADDTGIADLLKRLSEQGIEFKDLKTDQS
SLEDIFVSLVRAPQ