Protein Info for CCNA_03482 in Caulobacter crescentus NA1000

Annotation: ABC transporter permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 52 to 74 (23 residues), see Phobius details amino acids 103 to 125 (23 residues), see Phobius details amino acids 137 to 161 (25 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details amino acids 198 to 216 (19 residues), see Phobius details amino acids 222 to 245 (24 residues), see Phobius details PF01061: ABC2_membrane" amino acids 5 to 216 (212 residues), 107.4 bits, see alignment E=7.9e-35 PF12698: ABC2_membrane_3" amino acids 55 to 243 (189 residues), 35.2 bits, see alignment E=7.9e-13

Best Hits

Swiss-Prot: 40% identical to YADH_SHIFL: Inner membrane transport permease YadH (yadH) from Shigella flexneri

KEGG orthology group: K01992, ABC-2 type transport system permease protein (inferred from 100% identity to ccr:CC_3372)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CBP8 at UniProt or InterPro

Protein Sequence (253 amino acids)

>CCNA_03482 ABC transporter permease protein (Caulobacter crescentus NA1000)
MNLYAIKAIYKFEMARWFRTLAQSVISPVLSTSLYFVVFGSAIGSRMQAIDGISYGAFIV
PGLIMLSLLSESISNASFGIYMPKWAGTIYELLSAPVAWYETVIGYVGAAATKSICLGLL
ILATARIFVPFEIAHPFVMLLFLVLTSVTFSLFGFIIGVWADDFQKLQIVPLLIVTPLTF
LGGSFYSIKMLPELWQKITLFNPVVYLISGFRWAFYGQSDVGVGVSLAMTTVFLAVCLTA
VWWIFRTGYRLKV