Protein Info for CCNA_03478 in Caulobacter crescentus NA1000

Annotation: AraC-family transcription regulator FtrA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 transmembrane" amino acids 103 to 121 (19 residues), see Phobius details PF01965: DJ-1_PfpI" amino acids 18 to 175 (158 residues), 53 bits, see alignment E=7.4e-18 PF12833: HTH_18" amino acids 237 to 315 (79 residues), 68.8 bits, see alignment E=8.2e-23

Best Hits

KEGG orthology group: K13633, AraC family transcriptional regulator, transcriptional activator FtrA (inferred from 100% identity to ccr:CC_3367)

Predicted SEED Role

"Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CCD4 at UniProt or InterPro

Protein Sequence (319 amino acids)

>CCNA_03478 AraC-family transcription regulator FtrA (Caulobacter crescentus NA1000)
MPNASPLVVALAYDGLCTFEYGVAVELFALPRPEMGEGWYRFATAAVEPGDLRGLGGVHV
VGDGGLELLAGASIIVAPGWRGLDAPVPRPLIEALRAAHAGGARLMSICSGVFVLAATGL
LDGRRATTHWRYADALRAHHPAIQVQPDVLYVDEGDVLTSAGSAAGIDLGLHLIRRDFGP
EAANTVARRLVVPPHRDGGQAQFVQRPVPVAHEASRLGPILDQMRANLADEHTIKTLAAL
AGMSERTFLRRFEAVTGATPARWLLAERLNHARDLLETASTSIDQVARAVGLGAPALRHH
FRRQFSTTPGAYRARFART