Protein Info for CCNA_03469 in Caulobacter crescentus NA1000

Annotation: arginyl-tRNA synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF03485: Arg_tRNA_synt_N" amino acids 3 to 86 (84 residues), 61.4 bits, see alignment E=1.6e-20 TIGR00456: arginine--tRNA ligase" amino acids 3 to 600 (598 residues), 375.9 bits, see alignment E=1.5e-116 PF00750: tRNA-synt_1d" amino acids 107 to 176 (70 residues), 80.5 bits, see alignment E=1.8e-26 amino acids 209 to 470 (262 residues), 168.8 bits, see alignment E=2.5e-53 PF05746: DALR_1" amino acids 485 to 600 (116 residues), 96.9 bits, see alignment E=1.3e-31

Best Hits

Swiss-Prot: 100% identical to SYR_CAUVC: Arginine--tRNA ligase (argS) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K01887, arginyl-tRNA synthetase [EC: 6.1.1.19] (inferred from 100% identity to ccr:CC_3359)

Predicted SEED Role

"Arginyl-tRNA synthetase (EC 6.1.1.19)" (EC 6.1.1.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8H4W0 at UniProt or InterPro

Protein Sequence (600 amino acids)

>CCNA_03469 arginyl-tRNA synthetase (Caulobacter crescentus NA1000)
MNDLKRSLSEAAAAAFQAAGLPPEFGRVTASDRPDLADFQCNGALAAAKSAKRNPREIAV
QVVDILKGDPRLASVEIAGVGFINMRVSDEALSARAREIASDDRTGAQLLETPRRVLIDY
AGPNVAKPMHVGHLRASIIGESVKRLYRFRGDDVVGDAHFGDWGFQMGLLISAIMDEDPF
INALMEKLPEAPRGFSSADEAKVMAEFEKRITLADLDRIYPAASVRQKEDPAFKERARKA
TAELQNGRFGYRLLWRHFVNVSRVALEREFHALGVDFDLWKGESDVNDLIEPMVLQLEAK
GLLVQDQGARIVRVAREGDKRDVPPLLVVSSEGSAMYGTTDLATILDRRKSFDPHLILYC
VDQRQADHFETVFRAAYLAGYAEEGALEHIGFGTMNGADGKPFKTRAGGVLKLHDLIEMA
REKARERLREAGLGAELSEEQFEDTAHKVGVAALKFADLQNFRGTSYVFDLDRFTSFEGK
TGPYLLYQSVRIKSVLRRAAESGAVAGRVEIHEPAERDLAMLLDAFEGALQEAYDKKAPN
FVAEHAYKLAQSFSKFYAACPIMSADTETLRASRLTLAETTLRQLELALDLLGIEAPERM