Protein Info for CCNA_03463 in Caulobacter crescentus NA1000

Annotation: glycine cleavage system protein P, N-terminal domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 PF02347: GDC-P" amino acids 1 to 436 (436 residues), 395.7 bits, see alignment E=3.9e-122 PF00266: Aminotran_5" amino acids 110 to 377 (268 residues), 35.3 bits, see alignment E=1e-12 PF01053: Cys_Met_Meta_PP" amino acids 116 to 258 (143 residues), 30.4 bits, see alignment E=2.4e-11

Best Hits

Swiss-Prot: 100% identical to GCSPA_CAUVN: Probable glycine dehydrogenase (decarboxylating) subunit 1 (gcvPA) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K00282, glycine dehydrogenase subunit 1 [EC: 1.4.4.2] (inferred from 100% identity to ccr:CC_3353)

Predicted SEED Role

"Glycine dehydrogenase [decarboxylating] (glycine cleavage system P1 protein) (EC 1.4.4.2)" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle) (EC 1.4.4.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.4.2

Use Curated BLAST to search for 1.4.4.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8H4V4 at UniProt or InterPro

Protein Sequence (448 amino acids)

>CCNA_03463 glycine cleavage system protein P, N-terminal domain (Caulobacter crescentus NA1000)
MRYLPLTPEDRVEMLGAIGVKSIDDLFVDVPVSARRDAPVDLPHHAGELDVEREMAGLAR
RNRAAGEGPFFCGAGAYRHHVPATVDHIIQRSEFLTSYTPYQPEIAQGTLQVLFEFQTQV
AALTGMEVANASLYDGSTGAAEAVMMAQRVTRRNKAVMSGGVHPHYVGAIETLAHAAGVA
TQALPAAVDAEDAVIAAIDQDTACVVVQTPNVFGTVTDVSKIAEAAHAAGALLIVVTTEA
VSFGLLKSPGEMGADIAVAEGQSIGNGLNFGGPYVGLFACKEKFVRQMPGRLCGETVDAD
GKRGFVLTLSTREQHIRRDKATSNICTNSGLCALAFSIHMSLLGETGLRQLAAVNHQKAL
ALRDALKAVPGVEILTPRFFNEFAIRVPGKAAEVVEILAAHGVIAGVPFSRLDAKAGLDD
VLLVAATETTLDIDIPVFAKALTKVFAQ