Protein Info for CCNA_03462 in Caulobacter crescentus NA1000

Annotation: glycine cleavage system protein P, C-terminal domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 526 PF02347: GDC-P" amino acids 76 to 472 (397 residues), 29.9 bits, see alignment E=4.2e-11 PF00266: Aminotran_5" amino acids 203 to 305 (103 residues), 34.7 bits, see alignment E=1.6e-12 PF21478: GcvP2_C" amino acids 384 to 480 (97 residues), 75.8 bits, see alignment E=4.3e-25

Best Hits

Swiss-Prot: 100% identical to GCSPB_CAUVC: Probable glycine dehydrogenase (decarboxylating) subunit 2 (gcvPB) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K00283, glycine dehydrogenase subunit 2 [EC: 1.4.4.2] (inferred from 100% identity to ccr:CC_3352)

Predicted SEED Role

"Glycine dehydrogenase [decarboxylating] (glycine cleavage system P2 protein) (EC 1.4.4.2)" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle) (EC 1.4.4.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.4.2

Use Curated BLAST to search for 1.4.4.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CCC5 at UniProt or InterPro

Protein Sequence (526 amino acids)

>CCNA_03462 glycine cleavage system protein P, C-terminal domain (Caulobacter crescentus NA1000)
MSMNNVGRPTRPEAANDAANGHETLTGARGLLQDEALIFELDGWNKTGVDLPPVTAAPSS
DLNGLLRDAPIGLPGLSEPETVRHYVRLSQKNHAIDLALYPLGSCTMKHNPRLNEKMARL
PGFSDIHPLQPQSTVQGALELMDRLAHWLKTLTGMPAVALTPKAGAHGELCGLLAIRAAH
EAAGNGHRKTVLAPTSAHGTNPATAAFVGYTVVEIAQTEDGRVDLADLESKLGDHVAAIM
VTNPNTCGLFERDVVEIARLTHAAGAYFYCDGANFNAIVGRVRPGDLGVDAMHINLHKTF
STPHGGGGPGAGPVVLSEALAPFAPTPWLTHGDNGFELAEHAGDDDAKTAFGRMSAFHGQ
MGMYVRAYAYMLSHGADGLRQVAEDAVLNANYIKAQLKDVMSPAFPEGPCMHEALFDDSW
LEGTGVTTLDFAKAMIDEGFHPMTMYFPLVVHGAMLIEPTETESKHELDRFIAALRALAG
AAKAGDTERFKGAPFHAPLRRLDETQAARKPRLRWKPVAAAPLAAE