Protein Info for CCNA_03436 in Caulobacter crescentus NA1000

Annotation: CHASE sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 761 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 294 to 315 (22 residues), see Phobius details amino acids 321 to 341 (21 residues), see Phobius details amino acids 346 to 365 (20 residues), see Phobius details PF05226: CHASE2" amino acids 28 to 311 (284 residues), 174.5 bits, see alignment E=5.1e-55 PF08448: PAS_4" amino acids 426 to 527 (102 residues), 56 bits, see alignment E=6.7e-19 PF02518: HATPase_c" amino acids 639 to 754 (116 residues), 75 bits, see alignment E=9.4e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_3327)

Predicted SEED Role

"sensory box histidine kinase, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CBK8 at UniProt or InterPro

Protein Sequence (761 amino acids)

>CCNA_03436 CHASE sensor histidine kinase (Caulobacter crescentus NA1000)
MRETGSRPSRSGERRLSWLWLAMAASLVFAVFAVRPPSRIDNVLYDVLTRANAHPADDSI
LIVDIDDRSLARMGAWPWGRDTHARMVDQLTQAGAKTIVYDVLFSQPSRDPAQDRALGEA
IARSGRVYLPEFLIDGGEQAPPRVVGSISEIARGAAGVGLAHVRFDDDGVVRRMAPFEAN
GPSLKPDLMTVVHRATRPPGSPDVTRGNEQTLLISFAGPPSIYRHASFASVLDGEVPREL
IAGRTVFVGLTAPGLGPAFPTPVTPDAASMTGVQLQASVLDALRSGRMITPAGPWSRVGF
SLTLLWLLMIGFMALPPRANLLLTIGLCLVGLAYSAALFWLGHIWLSPITTVIGLQLVAL
IWGWGRLGQVNDLIGRELARVRAVVRGRGAKPAAFSGDVVTRQASSLGDAITRMDDLRRF
SADALFSLPDATLVANEQGRVIAANAAAQALFKPHQATLNGASLADLINLLDPLGRRFEL
DWPQATDRHDPIDLHLPDGRAFQLQTVLRRDEHGGPAGWIVRLADISILTAAMRQREQAL
QLLTHDMRSPQTSILALLATTPDLPKETADRIAAYARRTLALADGFVQLARAEVTPVSLE
PLDLADVAVEAIDEVWPQSLQRKIRIEQVGGEAPLMVLGDRSVLARTFVNLLGNALKYSP
SGSTITVNLAEQPSPSGPVACIAIADQGPGFSREEAATAFRPFQRFERPGHELASNGVGL
GLAFVQAAVARHGGEVSCRSEPGVGAEFTVRLPRHGVVQGG