Protein Info for CCNA_03431 in Caulobacter crescentus NA1000

Annotation: membrane-bound lytic murein transglycosylase B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR02283: lytic murein transglycosylase" amino acids 58 to 354 (297 residues), 378.5 bits, see alignment E=1.1e-117 PF13406: SLT_2" amino acids 59 to 350 (292 residues), 330 bits, see alignment E=1.3e-102 PF01471: PG_binding_1" amino acids 371 to 425 (55 residues), 52 bits, see alignment 6.4e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_3322)

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase B precursor (EC 3.2.1.-)" in subsystem Peptidoglycan Biosynthesis (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CBK3 at UniProt or InterPro

Protein Sequence (433 amino acids)

>CCNA_03431 membrane-bound lytic murein transglycosylase B (Caulobacter crescentus NA1000)
MAMDRRVFLVLLLAGCADTSPQGPLTAISPAPPPAPTPQTTVTPAPTPQTPVPAGELAFD
TWMQDFRGRAIAAGLSPDLLDRELGGVIPDPRVISLDSRQPEFSKPVGDYIRGVISEDRV
AIGRSKRDQLDFLSQIESRYGVPGDILLAVWAMESAFGQLQGNFDVVRSMVSLAADGRRR
AWAEGELIAALKIIDSGEVTRAQLKGSWAGAMGQTQFIPTSFRATAVDFDGDGRRDIWGS
DADALASAANLLVRGGWKRNVGWAREVILPPGFDYSVTEGPREIPAWWEARGVRRADGLP
WTAQDAASPAMLILPAGATGPAFLALPNHFAIRTYNNSTSYALGIGLLADRFAGGAPPIT
PWPVETPLSMSDRMAAQIALARVGFNPGPADGVIGAGTRRALRAWQQSQQLPADGYLSND
MVARLKAQAGISP