Protein Info for CCNA_03429 in Caulobacter crescentus NA1000

Annotation: haloacid dehalogenase superfamily, subfamily IA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 PF00702: Hydrolase" amino acids 7 to 183 (177 residues), 44.4 bits, see alignment E=2.6e-15 PF13419: HAD_2" amino acids 76 to 186 (111 residues), 29.9 bits, see alignment E=5.4e-11 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 133 to 187 (55 residues), 49.4 bits, see alignment E=2.8e-17

Best Hits

KEGG orthology group: K07025, putative hydrolase of the HAD superfamily (inferred from 100% identity to ccr:CC_3320)

Predicted SEED Role

"Hydrolase, haloacid dehalogenase-like family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CEW8 at UniProt or InterPro

Protein Sequence (205 amino acids)

>CCNA_03429 haloacid dehalogenase superfamily, subfamily IA (Caulobacter crescentus NA1000)
MTRSRPRAVLWDVGNVIVRWDPRALYAKIFKEPADLDRFLSHVCTLDWHVEHDRGVSFAD
NAAPLIARFPEHAAEIRAWDERFDEMLSGPIPETVSVIEALAARETPQFALTNMPQSKWP
IVQAKSPAHFGHFRDAVVSGDEGVIKPHRRIYEIVLERTGLAADDLLFIDDSAANIAAAA
EMGFHTHHFTDPAALREAVASHGLL