Protein Info for CCNA_03412 in Caulobacter crescentus NA1000

Annotation: NAD(P) transhydrogenase subunit beta PntB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 36 to 54 (19 residues), see Phobius details amino acids 60 to 81 (22 residues), see Phobius details amino acids 92 to 114 (23 residues), see Phobius details amino acids 132 to 153 (22 residues), see Phobius details amino acids 172 to 190 (19 residues), see Phobius details amino acids 196 to 217 (22 residues), see Phobius details amino acids 224 to 243 (20 residues), see Phobius details amino acids 249 to 268 (20 residues), see Phobius details PF02233: PNTB" amino acids 8 to 470 (463 residues), 638.4 bits, see alignment E=3.9e-196

Best Hits

Swiss-Prot: 71% identical to PNTB_RHORU: NAD(P) transhydrogenase subunit beta (pntB) from Rhodospirillum rubrum

KEGG orthology group: K00325, NAD(P) transhydrogenase subunit beta [EC: 1.6.1.2] (inferred from 100% identity to ccs:CCNA_03412)

Predicted SEED Role

"NAD(P) transhydrogenase subunit beta (EC 1.6.1.2)" in subsystem Phosphate metabolism (EC 1.6.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.1.2

Use Curated BLAST to search for 1.6.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CEU9 at UniProt or InterPro

Protein Sequence (472 amino acids)

>CCNA_03412 NAD(P) transhydrogenase subunit beta PntB (Caulobacter crescentus NA1000)
MNANLAAILYLVSGVLFILALRGLSSPVTSQTGNRNGMIGMAIAVGTTLATLWSQGALDA
VTLGLILGGVAVGGAVGAVIARRVAMTSMPQLVAAFHSLVGMAACLVAVAAIYTPAAYGI
VGEDGAIHGASLIELSLGLAIGAITFTGSVIAFAKLNGNMGGAPILLPARHLLNIIIAVA
IVALIVVLVASGGSAIWAFWGIFALSLLIGVTLIIPIGGADMPVVVSMLNSYSGWAAAAL
GFTLENTTLIITGALVGSSGAILSYIMCKGMNRSFVSVILGGFGADAAAAGPGGKVETRP
VKQGSADDAAFIMKNASKVIIVPGYGMAVSQAQHALREMADKLKEEGVEVKYAIHPVAGR
MPGHMNVLLAEANVPYDEVFELEDINSEFSTADVAFVIGANDVTNPAAKTDPTSAIFGMP
ILDVEKARTVLFVKRGMASGYAGVENELFFRDNTMMLFGDAKKMVEGILKGL