Protein Info for CCNA_03384 in Caulobacter crescentus NA1000

Annotation: LSU ribosomal protein L31P

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 76 TIGR00105: ribosomal protein bL31" amino acids 1 to 70 (70 residues), 107.1 bits, see alignment E=1.8e-35 PF01197: Ribosomal_L31" amino acids 1 to 69 (69 residues), 83.1 bits, see alignment E=6.5e-28

Best Hits

Swiss-Prot: 100% identical to RL31_CAUVN: 50S ribosomal protein L31 (rpmE) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K02909, large subunit ribosomal protein L31 (inferred from 99% identity to cse:Cseg_0648)

Predicted SEED Role

"LSU ribosomal protein L31p @ LSU ribosomal protein L31p, zinc-independent"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8H4M5 at UniProt or InterPro

Protein Sequence (76 amino acids)

>CCNA_03384 LSU ribosomal protein L31P (Caulobacter crescentus NA1000)
MKQDIHPDYHFITVTLTDGSSYKTRSTYGKEGANLALDIDPRTHPAWTGGNAQLMDRGGR
VSRFNAKFAGFTGKKA