Protein Info for CCNA_03373 in Caulobacter crescentus NA1000

Annotation: thiamin-phosphate pyrophosphorylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00693: thiamine-phosphate diphosphorylase
  • amino acids 6 to 197 (192 residues), 163.8 bits, E=1.5e-52
• PF02581: TMP-TENI
  • amino acids 7 to 187 (181 residues), 183.5 bits, E=1.3e-58

Best Hits

Swiss-Prot: 80% identical to THIE_CAUSK: Thiamine-phosphate synthase (thiE) from Caulobacter sp. (strain K31)

KEGG orthology group: K00788, thiamine-phosphate pyrophosphorylase [EC: 2.5.1.3] (inferred from 100% identity to ccr:CC_3264)

Predicted SEED Role

"Thiamin-phosphate pyrophosphorylase (EC 2.5.1.3)" in subsystem Thiamin biosynthesis (EC 2.5.1.3)

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• thiamine diphosphate biosynthesis I (E. coli) (2/2 steps found)
• thiamine diphosphate biosynthesis II (Bacillus) (2/2 steps found)
• thiamine diphosphate salvage II (4/5 steps found)
• thiamine diphosphate salvage V (2/3 steps found)
• superpathway of thiamine diphosphate biosynthesis I (7/10 steps found)
• thiamine diphosphate biosynthesis III (Staphylococcus) (1/3 steps found)
• thiamine diphosphate biosynthesis IV (eukaryotes) (1/3 steps found)
• superpathway of thiamine diphosphate biosynthesis III (eukaryotes) (3/7 steps found)
• thiamine diphosphate salvage IV (yeast) (3/7 steps found)
• thiamine diphosphate formation from pyrithiamine and oxythiamine (yeast) (3/8 steps found)

KEGG Metabolic Maps

• Thiamine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.3

Use Curated BLAST to search for 2.5.1.3

Sequence Analysis Tools

See A0A0H3CD41 at UniProt or InterPro

Protein Sequence (214 amino acids)

>CCNA_03373 thiamin-phosphate pyrophosphorylase (Caulobacter crescentus NA1000)
MTLDCRLYLITPPALTDLADFGRQLARALEGGDVAALQIRLKDAPDDLVAAAVDVLGPIA
QARDVAVILNDRPDLAARLPVDGVHVGQSDMACRDARKLMGDRMVGVTCHDSRHLAMEAA
EAGADYVAFGAFFPTSTKDAPTRAEPDILTIWQETMETPCVAIGGITVENASGLATAGAD
FLAVSAGVWSYAQGPDAAVAALNAAIAEGLAARK