Protein Info for CCNA_03371 in Caulobacter crescentus NA1000

Annotation: bacterioferritin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00754: bacterioferritin
  • amino acids 1 to 156 (156 residues), 234.1 bits, E=3.6e-74
• PF00210: Ferritin
  • amino acids 9 to 142 (134 residues), 118.7 bits, E=9.9e-39

Best Hits

Swiss-Prot: 60% identical to BFR_AZOVI: Bacterioferritin (bfr) from Azotobacter vinelandii

KEGG orthology group: K03594, bacterioferritin (inferred from 100% identity to ccr:CC_3262)

MetaCyc: 58% identical to bacterioferritin (Escherichia coli K-12 substr. MG1655)
Ferroxidase. [EC: 1.16.3.1]

Predicted SEED Role

"Bacterioferritin" in subsystem Iron acquisition in Vibrio

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.16.3.1

Use Curated BLAST to search for 1.16.3.1

Sequence Analysis Tools

See A0A0H3CC54 at UniProt or InterPro

Protein Sequence (159 amino acids)

>CCNA_03371 bacterioferritin (Caulobacter crescentus NA1000)
MQGDPSIIRLLNAVLTNELTAVNQYFLHARMYDNWGFKRLGKITYDESIGEMKHADMLIN
RILFLEGLPNLQDLHKLKIGETVPECLNSDLQVELAGRETLIPGIIQCEQARDYVSRELL
RVILSDTEEHIDFLETQLSLVKSLGEANYLQSAMGELPA