Protein Info for CCNA_03360 in Caulobacter crescentus NA1000

Annotation: tagatose-1,6-bisphosphate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01521: fructose-bisphosphate aldolase, class II, Calvin cycle subtype
  • amino acids 3 to 349 (347 residues), 625.5 bits, E=2.4e-192
• TIGR00167: ketose-bisphosphate aldolase
  • amino acids 4 to 328 (325 residues), 316.3 bits, E=2e-98
• PF01116: F_bP_aldolase
  • amino acids 5 to 327 (323 residues), 310.1 bits, E=7.8e-97

Best Hits

Swiss-Prot: 73% identical to ALF2_RHOSH: Fructose-bisphosphate aldolase 2 (cfxB) from Rhodobacter sphaeroides

KEGG orthology group: K01624, fructose-bisphosphate aldolase, class II [EC: 4.1.2.13] (inferred from 100% identity to ccs:CCNA_03360)

MetaCyc: 65% identical to class II fructose-bisphosphate aldolase/sedoheptulose-1,7-bisphosphate aldolase monomer (Synechocystis sp. PCC 6803)
Fructose-bisphosphate aldolase. [EC: 4.1.2.13]; 4.1.2.13 [EC: 4.1.2.13]

Predicted SEED Role

"Fructose-bisphosphate aldolase class II (EC 4.1.2.13)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis (EC 4.1.2.13)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• glycolysis III (from glucose) (10/11 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (14/17 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• homolactic fermentation (10/12 steps found)
• glycolysis II (from fructose 6-phosphate) (9/11 steps found)
• pentose phosphate pathway (non-oxidative branch) II (5/6 steps found)
• gluconeogenesis I (10/13 steps found)
• glycolysis I (from glucose 6-phosphate) (10/13 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• gluconeogenesis III (9/12 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
• glycolysis VI (from fructose) (8/11 steps found)
• glycolysis IV (7/10 steps found)
• Calvin-Benson-Bassham cycle (9/13 steps found)
• sedoheptulose bisphosphate bypass (1/2 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (6/9 steps found)
• superpathway of hexitol degradation (bacteria) (12/18 steps found)
• ethene biosynthesis V (engineered) (17/25 steps found)
• glycolysis V (Pyrococcus) (6/10 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)
• sucrose degradation V (sucrose α-glucosidase) (2/5 steps found)
• oxygenic photosynthesis (10/17 steps found)
• 1,3-propanediol biosynthesis (engineered) (4/9 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (11/19 steps found)
• superpathway of N-acetylneuraminate degradation (12/22 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (7/18 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (18/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Carbon fixation in photosynthetic organisms
• Fructose and mannose metabolism
• Glycolysis / Gluconeogenesis
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.13

Sequence Analysis Tools

See A0A0H3CBD8 at UniProt or InterPro

Protein Sequence (363 amino acids)

>CCNA_03360 tagatose-1,6-bisphosphate aldolase (Caulobacter crescentus NA1000)
MARITLRQLLDHAAEHEYGLPAFNINNMEQGLAIMEAADAVNSPVIIQASRGARNYANDI
MLAKMIDALVDIYPHIPVCMHQDHGNGPATCATAIQYGFTSVMMDGSLMEDAKTPASYEY
NVEVTRKVVQMAHSCGVSVEGELGVLGSLETGMGEAEDGHGFEGKLSHDELLTDPDQAVD
FVAQTGVDALAIAMGTSHGAYKFTRKPDGDVLAMNVIEEIHRRLPNTHLVMHGSSSVPQD
LQDIINQYGGEMPQTWGVPVEEIQRGIKHGVRKINVDTDNRMAITGAIRKLLVEKPGEFD
PRAYLKPAKEAMRKVCQARFVEFGSAGHADKIKPMSTATMAKRYASGELHAKFGASAAKA
AAE