Protein Info for CCNA_03355 in Caulobacter crescentus NA1000

Annotation: acylamino-acid-releasing enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 661 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF02129: Peptidase_S15" amino acids 419 to 556 (138 residues), 42.2 bits, see alignment E=4.2e-14 PF01738: DLH" amino acids 424 to 644 (221 residues), 41.2 bits, see alignment E=7.3e-14 PF20434: BD-FAE" amino acids 430 to 619 (190 residues), 31.4 bits, see alignment E=6.9e-11 PF00561: Abhydrolase_1" amino acids 439 to 558 (120 residues), 29.5 bits, see alignment E=3e-10 PF12697: Abhydrolase_6" amino acids 441 to 569 (129 residues), 33.9 bits, see alignment E=2.6e-11 PF00326: Peptidase_S9" amino acids 454 to 660 (207 residues), 123.3 bits, see alignment E=5.4e-39

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_03355)

Predicted SEED Role

"prolyl oligopeptidase family protein" in subsystem Synechocystis experimental

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CC42 at UniProt or InterPro

Protein Sequence (661 amino acids)

>CCNA_03355 acylamino-acid-releasing enzyme (Caulobacter crescentus NA1000)
MGSSMKLRIALVLAGLCFGGPVLAAEGTAAAAFGAREYVQQISLSPDGKQVALVAPSGVR
GAKLLVIDIAAGTSKTILVSSGEPERLSGCRWSTETRLVCKIYAIIKSAENNVQYTRVLA
LNNDGSDMKMMTEAGNNRSIGVAQDGGSVIDWSADASASAILMTRNYLPEMTTNTRTASE
DDGLGVERVDTVTLARRSVEKPYPNAVEYISDGRGSVRILGLRPTRGTSGYAGARTAYLY
RQEGKREWLPLSQVVSGPTGYTGFNPYAVDPKLNVAYGFNEKDGRQALFKVSLDGSLTQD
LVLARPDVDVAGLVRIGRQDRVVGAYFVTDRRETEFFDPELRKLGAALGRALAGRIVTFI
DASADESKLLLFAGGDSDPGVYYIFDKSTRKLQDLTGARPQLEGLKLATVKAVTYPAADG
AQIPAYLTLPAGSDGRNLPAIVMPHGGPSARDEWGFDWLAQFFAHQGYAVLQPNYRGSSG
YGADWFQKNGFQSWRTAIGDVNDGGRWLQKEGIAAPGKLAIVGWSYGGYAALQSAVLDSD
LFKAVVAIAPVTDLEMLRNEFLNFENYLQASAFIGRGPHVTEGSPAQNAAAIKAPVLLFH
GDLDANVGIGESRLMERKLKAAGRSVELIEFKGLDHQLADDAARTQMLGKADAFLRTALG
F