Protein Info for CCNA_03343 in Caulobacter crescentus NA1000

Annotation: FtsW related protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 37 to 59 (23 residues), see Phobius details amino acids 66 to 86 (21 residues), see Phobius details amino acids 127 to 156 (30 residues), see Phobius details amino acids 163 to 180 (18 residues), see Phobius details amino acids 201 to 223 (23 residues), see Phobius details amino acids 235 to 252 (18 residues), see Phobius details amino acids 258 to 278 (21 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_3235)

Predicted SEED Role

"FIG00483696: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CCV6 at UniProt or InterPro

Protein Sequence (288 amino acids)

>CCNA_03343 FtsW related protein (Caulobacter crescentus NA1000)
MKASSMRLIRLLTAGLAAVGLAVSLAAISAAGAPRNALIVQALAAGLATGLALLVGWFWR
RARWRLWVLMAACGLALVLTLMNGVSLEGAKRWVALGPVQLHTASIVLPFAAFAFARGFG
DRRVAPIAALIALLLLYQHDAASSLAWALALAAAALVERPRQAIPWACVAIAGLLAYGAW
VEPDTLPAVPYVEGLLDQTFAANPVLGVLAGVLMISLPAPFLLVARARPERRAEALALAA
LWTGWIAGNLFGNYPAPVLGYGAAPILAWGLSLGLVLGDSVDQDPPAP