Protein Info for CCNA_03342 in Caulobacter crescentus NA1000

Annotation: short-chain acyl-CoA hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02799: tol-pal system-associated acyl-CoA thioesterase
  • amino acids 14 to 135 (122 residues), 147.8 bits, E=1.9e-47
• TIGR00051: acyl-CoA thioester hydrolase, YbgC/YbaW family
  • amino acids 17 to 123 (107 residues), 96.4 bits, E=1.4e-31
• PF13279: 4HBT_2
  • amino acids 23 to 136 (114 residues), 53.8 bits, E=2.6e-18
• PF03061: 4HBT
  • amino acids 29 to 111 (83 residues), 49.6 bits, E=4.1e-17

Best Hits

KEGG orthology group: K07107, acyl-CoA thioester hydrolase [EC: 3.1.2.-] (inferred from 100% identity to ccr:CC_3234)

Predicted SEED Role

"4-hydroxybenzoyl-CoA thioesterase family active site" in subsystem Ton and Tol transport systems

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Ubiquinone and menaquinone biosynthesis
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.-

Sequence Analysis Tools

See A0A0H3CC32 at UniProt or InterPro

Protein Sequence (147 amino acids)

>CCNA_03342 short-chain acyl-CoA hydrolase (Caulobacter crescentus NA1000)
MIEPTAGVFEGREHQLPVRIYYEDTDFTGIVYHANYLRYLERGRSDFFRAVGISHTELAK
QDTGFAVIRMELDFKRAARIDDALLVRTLFERAEGVRLHVRQTITRGDEVLFEATVVAVC
ISLSGRPRRPTPDMLAKLSPWLIPTDS