Protein Info for CCNA_03341 in Caulobacter crescentus NA1000

Annotation: TolQ protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 134 to 157 (24 residues), see Phobius details amino acids 176 to 199 (24 residues), see Phobius details TIGR02796: protein TolQ" amino acids 11 to 226 (216 residues), 262.7 bits, see alignment E=1.4e-82 PF01618: MotA_ExbB" amino acids 107 to 211 (105 residues), 116.6 bits, see alignment E=3.1e-38

Best Hits

KEGG orthology group: K03562, biopolymer transport protein TolQ (inferred from 100% identity to ccs:CCNA_03341)

Predicted SEED Role

"MotA/TolQ/ExbB proton channel family protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CBC4 at UniProt or InterPro

Protein Sequence (232 amino acids)

>CCNA_03341 TolQ protein (Caulobacter crescentus NA1000)
MDAAAAAPNFSFFALFMQADWVVKSVMIGLILASLGSWAVILDKLFRFQALNRAANRFEE
QVSGGRSLEDVAGEAGANPRHALPRMLQAALKEWRDAKSKGAMSETQAGFLIARIDRILD
TQIARETTKVEEGLGSLAIVATASPFIGLFGTVWGIMHAFQNIALSKNTSLAVVAPSIAE
ALFATAIGLIAAIPAYIAYNKFSTDAGKYAGRLEGFADDLSTAIQRRLAERV