Protein Info for CCNA_03340 in Caulobacter crescentus NA1000

Annotation: TolR protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 transmembrane" amino acids 27 to 53 (27 residues), see Phobius details PF02472: ExbD" amino acids 27 to 148 (122 residues), 101.1 bits, see alignment E=2.5e-33

Best Hits

KEGG orthology group: K03559, biopolymer transport protein ExbD (inferred from 100% identity to ccr:CC_3232)

Predicted SEED Role

"Biopolymer transport protein ExbD/TolR" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CEM6 at UniProt or InterPro

Protein Sequence (172 amino acids)

>CCNA_03340 TolR protein (Caulobacter crescentus NA1000)
MAMSSNDAFATGGRRGRRRGRRSRGALSEINVTPLVDVMLVLLIIFMISAPLLTAGVPLE
LPKTEAAALQNQDEPITVSIRKDGQIFVGETEIPFENLAPRIGAIAGDGYDKPIFVRADG
GATYAVVAQVMAGLSNAGFNKINLITETGGPSTGAAPRDAQPEGAADLRPAQ