Protein Info for CCNA_03338 in Caulobacter crescentus NA1000

Annotation: TolB protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details TIGR02800: Tol-Pal system beta propeller repeat protein TolB" amino acids 29 to 439 (411 residues), 493.5 bits, see alignment E=2.7e-152 PF04052: TolB_N" amino acids 39 to 140 (102 residues), 97.2 bits, see alignment E=9.1e-32 PF07676: PD40" amino acids 252 to 284 (33 residues), 37.1 bits, see alignment (E = 3.4e-13) amino acids 293 to 328 (36 residues), 49.5 bits, see alignment 4.5e-17 amino acids 380 to 415 (36 residues), 31.7 bits, see alignment 1.7e-11

Best Hits

Swiss-Prot: 100% identical to TOLB_CAUVC: Tol-Pal system protein TolB (tolB) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K03641, TolB protein (inferred from 100% identity to ccs:CCNA_03338)

Predicted SEED Role

"tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CCV1 at UniProt or InterPro

Protein Sequence (443 amino acids)

>CCNA_03338 TolB protein (Caulobacter crescentus NA1000)
MRLEKMNKETPMRLRALLLMVAALLSGAAFVTPAAAQIEVDINAGAVKPLPIAIPVFSGS
TRGAEIAQVITGNLERSGLFQPLNVAGVPDKLADVNVQPRFPDWQSTGAQALINGQVTVG
ADGGLRVDFRLWDVFSQQQLLGLQFSSTPDNWRRVAHKISDAVYERLTGEKGYFDTRVAF
VAESGPKLNRIKRLAIMDQDGANPQYLTDGSYIVMTPRFSSTSQELTYMALRPTGSSIYL
LNLETSRQETVGKFPGMVFAPRFSPDGSKVAFSVERNGNSDIYVMDLRSRATTRITTDPA
IDTSPSFSPDGTKIVFNSDRGGQAQIYVMNTDGSGVRRISYGGGRYTTPVWSPRGDFIAF
TKQTGGEFHIGVMRADGGDERLLTTSYLDEGPTWAPNGRVLMFFREGPSGNPRLWTVDIT
GRILRPAAYSGSASDPAWSPLLD