Protein Info for CCNA_03337 in Caulobacter crescentus NA1000

Annotation: peptidoglycan-associated lipoprotein pal

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details TIGR02802: peptidoglycan-associated lipoprotein" amino acids 80 to 181 (102 residues), 140.5 bits, see alignment E=9.2e-46 PF00691: OmpA" amino acids 82 to 177 (96 residues), 76.7 bits, see alignment E=7.3e-26

Best Hits

KEGG orthology group: K03640, peptidoglycan-associated lipoprotein (inferred from 100% identity to ccs:CCNA_03337)

Predicted SEED Role

"Outer membrane lipoprotein omp16 precursor" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CC28 at UniProt or InterPro

Protein Sequence (188 amino acids)

>CCNA_03337 peptidoglycan-associated lipoprotein pal (Caulobacter crescentus NA1000)
MRRNWMSFDTQRAARLALVGLAAASLAACASRPKPQPVTPPPAQPQPTQPTPYTPPAPPP
VTSGILPGSVQDFVVNIGDRVYFDTDEYVIRADAQPVLAGQAQWLNRYSSVRIRIEGNAD
ERGTREYNLALGARRANAVRDFLIAQGVSSARIETISFGKERPIDPGSSEEAWAKNRNGR
TAITDGAR