Protein Info for CCNA_03326 in Caulobacter crescentus NA1000

Annotation: two-component sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 657 transmembrane" amino acids 48 to 70 (23 residues), see Phobius details amino acids 178 to 200 (23 residues), see Phobius details PF00512: HisKA" amino acids 277 to 341 (65 residues), 63.4 bits, see alignment E=2.5e-21 PF02518: HATPase_c" amino acids 388 to 497 (110 residues), 107 bits, see alignment E=1.1e-34 PF00072: Response_reg" amino acids 530 to 645 (116 residues), 84.4 bits, see alignment E=9.3e-28

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_3219)

Predicted SEED Role

"sensor histidine kinase/response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CC19 at UniProt or InterPro

Protein Sequence (657 amino acids)

>CCNA_03326 two-component sensor histidine kinase (Caulobacter crescentus NA1000)
MFCRATLLSDGSEALGTFRHTLAKSEVLGAMSENRNHNVSSHAPLQARIAGVALATTVLA
LVAACLCFMLQQWSVARQEARANHEVLVQMAAAGAAAPLADHNMVGVYRALEAVAKAPGV
AGVRIIDAKGRAVAQLGEANPSNADTLQRPIKLSSQTVGTLVLVAKRPGLAQTLARDLAL
TGALFFGAAGMAILLANSLARRLAQPMERLSEAMHETAVGGRFKALEETADDDVFRSLIA
SFNHLVARLECNDQDLRGAMAELVKARDDANAANVLKSHFLANMSHEIRTPLNGVLAMAD
VMAMDQLSDIQRERLAVIRESGAVLLGVLNDVLDLSKIEAGRLEIQDRPFDIAQLAQSIR
ETFVPQARAKGLAFEVGVAPEAQGLWRGDADRLRQILGNLISNALKFTLDGAVAVRFASA
EDGSGLRIDVADTGIGISPEILPRLFDKFVQADSTTTRRFGGSGLGLAICRELAAMMNGS
IKVQSREGRGSTFTVLVGLPREETLTDVHYIDDGDPIMAPPAAEPPRLRVLAADDNPTNQ
KVVAAVLAPLNADVTLVDDGAACVEAWKTGDFDVVLMDIHMPVMDGLEAARSIRATEQAE
MRRRTPIIAVTANALTHQIEEYLSVGMDGHVAKPIEVSKLYDAIEAAMAGTRLSRAA