Protein Info for CCNA_03316 in Caulobacter crescentus NA1000

Annotation: UDP-N-acetylglucosamine 4,6-dehydratase/UDP-D-quinovosamine 4-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 627 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 36 to 54 (19 residues), see Phobius details amino acids 70 to 89 (20 residues), see Phobius details amino acids 96 to 116 (21 residues), see Phobius details PF04321: RmlD_sub_bind" amino acids 286 to 454 (169 residues), 58.7 bits, see alignment E=1.8e-19 PF08659: KR" amino acids 287 to 406 (120 residues), 23.3 bits, see alignment E=1.9e-08 PF02719: Polysacc_synt_2" amino acids 287 to 564 (278 residues), 330.9 bits, see alignment E=2.3e-102 PF01370: Epimerase" amino acids 287 to 497 (211 residues), 83.2 bits, see alignment E=6.8e-27 PF16363: GDP_Man_Dehyd" amino acids 288 to 444 (157 residues), 56.1 bits, see alignment E=1.5e-18 PF01073: 3Beta_HSD" amino acids 288 to 418 (131 residues), 34.7 bits, see alignment E=3.7e-12

Best Hits

KEGG orthology group: K13013, O-antigen biosynthesis protein WbqV (inferred from 100% identity to ccs:CCNA_03316)

Predicted SEED Role

"UDP-N-acetylglucosamine 4,6-dehydratase (EC 4.2.1.-)" in subsystem N-linked Glycosylation in Bacteria (EC 4.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.-

Use Curated BLAST to search for 4.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CEK5 at UniProt or InterPro

Protein Sequence (627 amino acids)

>CCNA_03316 UDP-N-acetylglucosamine 4,6-dehydratase/UDP-D-quinovosamine 4-dehydrogenase (Caulobacter crescentus NA1000)
MGHAGKIATHVLLAFVALLAGRYLVIDMPFTRDTLLQATLYGLAAFIVELAFRVERAPWR
FVSATDHLRLLRSAVLTAAAFLVITRLTHPGIDGGLRTVAGAALIQAALLSALRVIRRSL
HERMLLDSVLRLGPASMHPALPRLLIIGSASEAEAFLRAPAGLGERYAPIGVVSPLDRET
GDELRGVCVLGSIADFDSVLARLRDSGLSPAAILFLTDSAMSTFGAERLGRLKTEGVRLL
RRHGVVEMGAAANTPQLREISIEELLSRPPVRLDPEPVRALVSGRRVLVTGAGGSIGSEL
CRQIAASGCAHLTMVDASEYNLFHIEREIAERHPLLSRREALCDVRDAARVQRVFTEMKP
DIIFHAAALKHVTLVENHPCEGVRTNVLGTRNVAVAAKACGAAHLALISTDKAVAPTSVM
GAAKRVAEAVARQYGGGGDMRVSIVRFGNVLGSAGSVVPIFKSQIARGGPITLTHAEVER
YFMTIPEAVQLVLRAVALSMIASEPEAGVLTLEMGEPVKIIDLARRMIELQGLTPGRDID
IQITGLRPGEKLTETLVDVNEVARLKAPGIMEAVRLAPAPIIADERLAELDALAEVGDEA
GVRARLFALVEDLRQVGPSKVVKIRAS