Protein Info for CCNA_03306 in Caulobacter crescentus NA1000

Annotation: SSU ribosomal protein S12P

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00981: ribosomal protein uS12
  • amino acids 1 to 123 (123 residues), 216.2 bits, E=4.8e-69
• PF00164: Ribosom_S12_S23
  • amino acids 15 to 123 (109 residues), 134.4 bits, E=6.9e-44

Best Hits

Swiss-Prot: 100% identical to RS12_CAUVC: 30S ribosomal protein S12 (rpsL) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K02950, small subunit ribosomal protein S12 (inferred from 98% identity to cak:Caul_0801)

MetaCyc: 76% identical to 30S ribosomal subunit protein S12 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S12p (S23e)" in subsystem Ribosomal protein S12p Asp methylthiotransferase or Ribosome SSU bacterial

Sequence Analysis Tools

See B8H416 at UniProt or InterPro

Protein Sequence (123 amino acids)

>CCNA_03306 SSU ribosomal protein S12P (Caulobacter crescentus NA1000)
MPTINQLIRKPRSPKPVRNKVPALKGCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTTG
IEAVCYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRKQRRSLYGAK
RPK