Protein Info for CCNA_03300 in Caulobacter crescentus NA1000

Annotation: RND family efflux transporter, MFP subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 signal peptide" amino acids 1 to 41 (41 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 59 to 363 (305 residues), 179.4 bits, see alignment E=4.4e-57 PF25917: BSH_RND" amino acids 85 to 205 (121 residues), 29.4 bits, see alignment E=1.2e-10 PF25954: Beta-barrel_RND_2" amino acids 219 to 289 (71 residues), 36.5 bits, see alignment E=9.3e-13 PF25967: RND-MFP_C" amino acids 297 to 352 (56 residues), 24 bits, see alignment 6.2e-09

Best Hits

KEGG orthology group: K02005, HlyD family secretion protein (inferred from 100% identity to ccr:CC_3196)

Predicted SEED Role

"Membrane fusion protein of RND family multidrug efflux pump" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CC02 at UniProt or InterPro

Protein Sequence (369 amino acids)

>CCNA_03300 RND family efflux transporter, MFP subunit (Caulobacter crescentus NA1000)
MVARGRPDQGFRAMRPAPMTTRYLIATALVCAGVGLTACGGKKDAPAETAPASASARAVS
VGSVETRPLGGGIEASGLLVSREEAAVGSELTGYRVARLYADEGDWVRAGQPLVQLDDTL
LRAQIDQQAAVTAQAQAEAARVSGLDGQGVLSQEQIETRRYQAKAQEAALKELRTRASRM
TITAPVSGRVLSRGVQPGQIAGGGTAPWFTIARDGLVELDAEVNEADLGGIRAGQSVAVS
LPAGQALSGVVRLVSPRVDSTSRLGKVRIRLPVRPDLRPGGFGRATFGASGAPVTAVPES
AIRYEADGLFLMTVDSNNRAKQVPVKIGQKGGGWAQVVQGPSAGTRIVLGGAAFVTDGDV
IRPAQQAAR