Protein Info for CCNA_03299 in Caulobacter crescentus NA1000

Annotation: outer membrane protein oprM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 503 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 37 to 490 (454 residues), 225.4 bits, see alignment E=6.7e-71 PF02321: OEP" amino acids 80 to 274 (195 residues), 51.4 bits, see alignment E=6.1e-18 amino acids 302 to 488 (187 residues), 72.9 bits, see alignment E=1.5e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_03299)

Predicted SEED Role

"FIG00483008: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CB93 at UniProt or InterPro

Protein Sequence (503 amino acids)

>CCNA_03299 outer membrane protein oprM (Caulobacter crescentus NA1000)
MNFMRLATTGALLRPEQPVGLSRAAPIMTLMVLGLGLAACTTPARKAEVQLPSAYEAPAG
PALAPQALDQWWTQFNDPALNALVTTALAQSPDARLAAARLEEARAIRQGQIRQIFIPQT
PLVGSAQRTDTDINEQSGVGAFTQGGVSKTYSANFDVSWELDLIGRRLAALRVVKNDMAA
ARFAYEGARAALAANVAQSYFEARGLAVQLDDARESVRIARSLADVAAERGRRGLIATSE
GERAAADLAQAEAQAAALEAELRAARRTLLILVGKGVDPLETLPVTASLAKPPPVPAATP
GQLLARRPDVREAAARLASASGNLNISELALFPTLTLTPGGGISKAITPSFLDAGAQTST
TSSAWTIGANLSIPVLNIPKLMTDIKASNARVEQAAITYEKTVQTAFGEADNALVQLAAD
ERRVALLTAGERRAAVAYEASRKSFAAGLTDLTTALQAEQAWRAVRSASTAAQTQALQRA
VQTYKALGGGWSPEAVPTKASAQ