Protein Info for CCNA_03295 in Caulobacter crescentus NA1000

Annotation: PAS-family sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 642 TIGR00229: PAS domain S-box protein" amino acids 22 to 127 (106 residues), 45.7 bits, see alignment E=3.3e-16 PF00989: PAS" amino acids 28 to 118 (91 residues), 24.4 bits, see alignment E=1.1e-08 PF13426: PAS_9" amino acids 28 to 122 (95 residues), 42.1 bits, see alignment E=4.2e-14 PF08448: PAS_4" amino acids 30 to 124 (95 residues), 24.2 bits, see alignment E=1.5e-08 PF08447: PAS_3" amino acids 37 to 112 (76 residues), 40.6 bits, see alignment E=1.1e-13 amino acids 179 to 245 (67 residues), 30.7 bits, see alignment E=1.4e-10 PF00512: HisKA" amino acids 266 to 330 (65 residues), 71.4 bits, see alignment E=2.3e-23 PF02518: HATPase_c" amino acids 377 to 492 (116 residues), 89.8 bits, see alignment E=7.4e-29 PF00072: Response_reg" amino acids 516 to 627 (112 residues), 79.5 bits, see alignment E=9.5e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_03295)

Predicted SEED Role

"Sensory box histidine kinase/response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CBZ8 at UniProt or InterPro

Protein Sequence (642 amino acids)

>CCNA_03295 PAS-family sensor histidine kinase (Caulobacter crescentus NA1000)
MGKRLDTKAGARIEAAAADWFFQNSLDMFVVLRDSRIIRANPAWSQLTGWAAEDTLGREI
RDFFHLHDTEVLTAAGHTLKTVGHAHSENRLARKGGGWLWVRTQSTILEGGGQLIVFQDI
SEDRAREAARLQAERSNELLRNAAGVYVWRFNPRRGVYAFDQDIPTPSAPEGGARTMTVA
EMTQSIHPEDSARVWQAFSRTLQTGEHVEIDYRYLDPGADDWIHLHVAWRGVRGSSPDTY
DVIGITQNVTELVAARDAALAAAETKSQFLANMSHEIRTPMNGVLGVLHLLKTEKLSDDG
RRLLTEALSCGEMLSALLNDIIDFSKIEAGKLELSAEPVCPAELLRGVADMLRAQAETKG
LYLRVEASDDLGWVATDPLRLRQALFNLIGNAVKFTLEGGVVARLSGRRIDSPDGARLRL
RFEIDDTGVGIGEEAGARLFERFRQGDGSTTRRFGGSGLGLAICRRLAELMGGEVGFESQ
LGKGSTFWLEVETQACARPDTQETLADGPLFDGLHVLLVEDNATNRLIATRMLEALGARV
TTAEDGAQGVAAARQGFDLILMDIQMPVMDGVEATHRIRAFNSPAGAAPILAMTANAMAH
QQASYLAAGMDGAIAKPLSPLALTQAIAAALTLDPSRQRKAS