Protein Info for CCNA_03281 in Caulobacter crescentus NA1000
Annotation: AsnC-family transcriptional regulator
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 33% identical to LRP_RHIME: Leucine-responsive regulatory protein (lrp) from Rhizobium meliloti (strain 1021)
KEGG orthology group: None (inferred from 98% identity to cse:Cseg_0782)Predicted SEED Role
"Transcriptional regulator, AsnC family"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A0H3CCW8 at UniProt or InterPro
Protein Sequence (165 amino acids)
>CCNA_03281 AsnC-family transcriptional regulator (Caulobacter crescentus NA1000) MSEQLDAVDAKILDLIQHDAGLSVAEIAERVGLSSSPCWRRIKRLEDAGVIQRRVTILDR EKLGLGFEVYCTVKLSLPTKENLDTFEQAVGKWAEVVQCATVTGAADYEMRIVTRDMRAF DEFLRDKLLSLGLVSNIESRIVIRGVKNSTAVPLGLVSPYVSPLS