Protein Info for CCNA_03279 in Caulobacter crescentus NA1000

Annotation: short chain dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 237 to 253 (17 residues), see Phobius details PF00106: adh_short" amino acids 9 to 198 (190 residues), 180 bits, see alignment E=5.8e-57 PF08659: KR" amino acids 12 to 160 (149 residues), 45 bits, see alignment E=1.7e-15 PF13561: adh_short_C2" amino acids 15 to 216 (202 residues), 137.3 bits, see alignment E=9.9e-44

Best Hits

Swiss-Prot: 33% identical to LINX_SPHIB: 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase LinX (linX) from Sphingobium indicum (strain DSM 16412 / CCM 7286 / MTCC 6364 / B90A)

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_03279)

Predicted SEED Role

"short chain dehydrogenase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CBY5 at UniProt or InterPro

Protein Sequence (278 amino acids)

>CCNA_03279 short chain dehydrogenase (Caulobacter crescentus NA1000)
MAKNPFQDKVCIVTGAASGLGRALSAQLAEAGATLIIADINFPAAEELAHRMNQLGVTAK
PVRTDVTLSESVRQLIEGTAAEFGRIDYLFNNAGIAVFGEIRDLSLDHWRRVIDINLMGE
IYGIHYAYPQMIKQGFGHIVNVASGFGMAPGPVNSPYVASKFAVFGLSHALATEARAFGV
HVTVACPGFIKTPLVDNIHCVNAAPADVLANIPVAMVPVDRAANIILTGVAKRKMVIAFP
GYVGVLAFIHRFLPAVWDSMGKGEIARFRKIRKDPAVS