Protein Info for CCNA_03272 in Caulobacter crescentus NA1000

Annotation: two-component sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 PF08448: PAS_4" amino acids 23 to 131 (109 residues), 42.9 bits, see alignment E=1.6e-14 TIGR00229: PAS domain S-box protein" amino acids 141 to 264 (124 residues), 53.9 bits, see alignment E=1e-18 PF13188: PAS_8" amino acids 144 to 195 (52 residues), 29 bits, see alignment 2.2e-10 PF00989: PAS" amino acids 145 to 256 (112 residues), 31.7 bits, see alignment E=4.1e-11 PF13426: PAS_9" amino acids 161 to 257 (97 residues), 30.7 bits, see alignment E=9.5e-11 PF07568: HisKA_2" amino acids 279 to 329 (51 residues), 26.3 bits, see alignment 2e-09 PF07536: HWE_HK" amino acids 279 to 359 (81 residues), 102.2 bits, see alignment E=6.4e-33

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_03272)

Predicted SEED Role

"Chemotaxis protein methyltransferase CheR (EC 2.1.1.80)" in subsystem Bacterial Chemotaxis (EC 2.1.1.80)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.80

Use Curated BLAST to search for 2.1.1.80

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CB79 at UniProt or InterPro

Protein Sequence (473 amino acids)

>CCNA_03272 two-component sensor histidine kinase (Caulobacter crescentus NA1000)
MIEEAPPHPSAPMAASPSVTTALKHAPLGIAIFDNQMRYLAASRQYLTDQHLPPDLPLIG
RLHYDAFPEVPQKWRDLHARVLAEGVELRHEGDPYVDREGRTQWIRWSMAPWRTDGGGIG
GLVLYTEVVTAGILARRALEAAEARYRAVFDQTAMGVARLAQDGAILEANDSFCAILRRP
REQLLGSRITTLVHEHDLAQALADGEALTRGAIDTYTADRRFRGEQPDEILWLNLTVSKV
SPAEEPPYLVVILSDISHRKLAESAQQHHQAQLRLLINELNHRVKNTLATVQSMAAQTLR
NEPSPAVAFEKFEARLMGLSGVHDILTRESWHGAPLREVAERALRPFDEGGTRIEIAGPP
IRLQPGGALTMALILHELATNALKYGALSCAEGRVRLFWGYDADSRTLDCQWIEAGGPPV
VAPTRKGFGSRLIERSLRGELKGEATMDYHPDGLRCVLRAHIPETAQDKGSTL