Protein Info for CCNA_03271 in Caulobacter crescentus NA1000

Annotation: methionine gamma-lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01328: methionine gamma-lyase
  • amino acids 5 to 395 (391 residues), 728.1 bits, E=1.1e-223
• PF01053: Cys_Met_Meta_PP
  • amino acids 9 to 393 (385 residues), 470 bits, E=1.1e-144
• PF01041: DegT_DnrJ_EryC1
  • amino acids 62 to 190 (129 residues), 28.6 bits, E=2.1e-10
• PF06838: Met_gamma_lyase
  • amino acids 65 to 227 (163 residues), 26.9 bits, E=4.7e-10
• PF00155: Aminotran_1_2
  • amino acids 65 to 285 (221 residues), 38.8 bits, E=1.7e-13
• PF00266: Aminotran_5
  • amino acids 86 to 215 (130 residues), 29.3 bits, E=1.1e-10

Best Hits

Swiss-Prot: 62% identical to MEGL_PSEPU: L-methionine gamma-lyase (mdeA) from Pseudomonas putida

KEGG orthology group: K01761, methionine-gamma-lyase [EC: 4.4.1.11] (inferred from 100% identity to ccs:CCNA_03271)

MetaCyc: 62% identical to MdeA (Pseudomonas putida)
Methionine gamma-lyase. [EC: 4.4.1.11]

Predicted SEED Role

"Methionine gamma-lyase (EC 4.4.1.11)" in subsystem Methionine Degradation (EC 4.4.1.11)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
• L-methionine degradation II (3/3 steps found)
• seleno-amino acid detoxification and volatilization III (2/3 steps found)
• dimethyl sulfide biosynthesis from methionine (1/2 steps found)
• seleno-amino acid detoxification and volatilization I (1/2 steps found)
• L-threonine degradation I (3/6 steps found)
• superpathway of L-threonine metabolism (9/18 steps found)
• superpathway of seleno-compound metabolism (8/19 steps found)
• hypoglycin biosynthesis (4/14 steps found)

KEGG Metabolic Maps

• Methionine metabolism
• Selenoamino acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.4.1.11

Sequence Analysis Tools

See A0A0H3CCV9 at UniProt or InterPro

Protein Sequence (401 amino acids)

>CCNA_03271 methionine gamma-lyase (Caulobacter crescentus NA1000)
MRDDQTGFSTRAIHAGYDPADEHGALTPPLHLTSTFAFESAEAGGEMFAGTREGHFYSRI
SNPTTDLLERRLASLEGAEAAVATASGMGAITATLWSFLRAGDEVITDQTLYGCTFAFLR
DGLTRFGVTVKQVDMTRPETLAAAISDQTRIVYFETPANPNMRLVDIAAITRIAHAAGAK
VVVDNTYATPCLTRPLALGADIVVHSATKYLGGHGDLVGGIAAGGIEDMARVRLCGVKDM
TGAVMSPFTAFLVLRGLKTLSLRMARHSQSAQAVARWLEDHPAVEQVFYPGLQSFPQRDL
AARQMAAGGGMMAFELKGGHAAGVAMMNRLALIRRAVSLGDAETLIQHPASMTHSPYTPE
ERAAAGIGEGMVRLSVGLEDVADILADLAMALEPLKVAQPA