Protein Info for CCNA_03269 in Caulobacter crescentus NA1000

Annotation: glucokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 transmembrane" amino acids 230 to 252 (23 residues), see Phobius details amino acids 290 to 310 (21 residues), see Phobius details PF02685: Glucokinase" amino acids 7 to 307 (301 residues), 208.7 bits, see alignment E=5.9e-66

Best Hits

Swiss-Prot: 100% identical to Y3167_CAUVC: Glucokinase-like protein CC_3167 (CC_3167) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K00845, glucokinase [EC: 2.7.1.2] (inferred from 100% identity to ccs:CCNA_03269)

Predicted SEED Role

"Glucokinase (EC 2.7.1.2)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis (EC 2.7.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.2

Use Curated BLAST to search for 2.7.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CCQ6 at UniProt or InterPro

Protein Sequence (325 amino acids)

>CCNA_03269 glucokinase (Caulobacter crescentus NA1000)
MAKGSVLLADVNGRDLALALVSPGDAPRGHRDLACASLKALEEHLIDAVSEHSADGLIGA
AVCGAGPEIDGAIALTAGDFTLTQAWLRAVLKTPRVSLLNDFAACALGAPRLAPSAMRLI
HEGKPGRNAQIAVIGPNLGLGVAALTPHRTDGWTPVVSEGGHIDFTPGEPREVPVFEALQ
ARHGRVSAEHFLSQQGLADIYAALGGGLDDSDEVILARVRDGDETAREALSIFSALLGAF
AGDAALSFAARGGVYINSPLMERIDGLLDQAAFSRRFEDKGRMSAYLKDIPVYLAVGRCT
LLGLSALFTASDLRYEAAEVKVLDC