Protein Info for CCNA_03262 in Caulobacter crescentus NA1000

Annotation: queuosine biosynthesis protein QueC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR00364: queuosine biosynthesis protein QueC" amino acids 9 to 225 (217 residues), 202.4 bits, see alignment E=2.8e-64 PF06508: QueC" amino acids 9 to 232 (224 residues), 237.6 bits, see alignment E=5.3e-75

Best Hits

Swiss-Prot: 100% identical to QUEC_CAUVN: 7-cyano-7-deazaguanine synthase (queC) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K06920, queuosine biosynthesis protein QueC (inferred from 100% identity to ccr:CC_3160)

Predicted SEED Role

"Queuosine Biosynthesis QueC ATPase" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8H3X3 at UniProt or InterPro

Protein Sequence (242 amino acids)

>CCNA_03262 queuosine biosynthesis protein QueC (Caulobacter crescentus NA1000)
MSPRERQAALVLFSGGQDSSVCLAWALERYDRVETVGFDYGQRHAIEMQARQAVRREVAA
RFPQWAERLGEDHVLDIRSFGAVAQSALTADRAIEMTERGLPSTFVPGRNLVFLTYAAAL
ADRRGIDALVGGMCETDFSGYPDCRRDTLDAMQAALNLGMDRNFRIETPLMWLTKAQTWG
LSKQLGGEALVSLIVEESHTCYQGERGQLHAWGHGCGTCPACELREKGYVEWDMAGREAL
AQ