Protein Info for CCNA_03243 in Caulobacter crescentus NA1000

Annotation: NADP+-dependent gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 499 PF00171: Aldedh" amino acids 31 to 494 (464 residues), 565.9 bits, see alignment E=2.8e-174

Best Hits

Swiss-Prot: 44% identical to AL2B4_ARATH: Aldehyde dehydrogenase family 2 member B4, mitochondrial (ALDH2B4) from Arabidopsis thaliana

KEGG orthology group: K09472, gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase [EC: 1.2.1.-] (inferred from 100% identity to ccs:CCNA_03243)

MetaCyc: 56% identical to 4-guanidinobutyraldehyde dehydrogenase (Pseudomonas putida)
Gamma-guanidinobutyraldehyde dehydrogenase. [EC: 1.2.1.54]

Predicted SEED Role

"Gamma-glutamyl-aminobutyraldehyde dehydrogenase (EC 1.2.1.-)" (EC 1.2.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.-

Use Curated BLAST to search for 1.2.1.- or 1.2.1.54

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CB65 at UniProt or InterPro

Protein Sequence (499 amino acids)

>CCNA_03243 NADP+-dependent gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase (Caulobacter crescentus NA1000)
MPRVTLPADMTERLAKLAPPSQAVIDGDLVEAASGATFHNVSPRDGQVLNLVTACQADDV
ERAVAGARAAFEDGRWRDQGPRQKKAVLFRLAELMERDADELALLESLDVGKPISDARNV
DIPLAINTCRWYAEALDKVYGEVGTSPADRLSYAVHEPLGVIGAIVPWNFPLHMAMWKVA
PALAMGNSVVLKPAEQSPLTALKLGALALEAGLPPGVLNVIPGLGGVAGEALALSMDVDM
IAFTGSGPVGRRLMEYSARSNLKRVSLELGGKSPQIVFADCPDLEAAAQAAAWGVFYNQG
EVCTAASRLLVEAPIKDAFLARVIEVAKGMKVGDPLDPSTQFGAMVSERQMNTALDYIAT
ADSQGARRVLGGQRVRQEAGGFYVEPTIFDQVRPDQTLAREEVFGPVLGVMTFSSEDEAM
RLANDTVYGLAAGLWTADVSKALRGARRLKAGLVWVNGWDACDITMPFGGFKQSGFGRDR
SLHALHKYADLKSVSVTLR