Protein Info for CCNA_03235 in Caulobacter crescentus NA1000

Annotation: spermidine/putrescine transport ATP-binding protein potA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 PF00005: ABC_tran" amino acids 30 to 172 (143 residues), 141.3 bits, see alignment E=5.1e-45 TIGR01187: polyamine ABC transporter, ATP-binding protein" amino acids 45 to 379 (335 residues), 395 bits, see alignment E=1.2e-122 PF08402: TOBE_2" amino acids 291 to 378 (88 residues), 66.9 bits, see alignment E=2.1e-22

Best Hits

KEGG orthology group: K11072, spermidine/putrescine transport system ATP-binding protein [EC: 3.6.3.31] (inferred from 100% identity to ccs:CCNA_03235)

Predicted SEED Role

"Putrescine transport ATP-binding protein PotG (TC 3.A.1.11.2)" in subsystem Polyamine Metabolism (TC 3.A.1.11.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CCT0 at UniProt or InterPro

Protein Sequence (381 amino acids)

>CCNA_03235 spermidine/putrescine transport ATP-binding protein potA (Caulobacter crescentus NA1000)
MCRGISAMTTPKPIITFENVTKRFGKLAAVDNVSLTVNEGEFFALLGPSGCGKTTLLRML
AGFETPTEGRILIDGQDISNVPPNKRPVNMVFQSYAVFPHMTVADNVAYGLKVDNVPKAE
REARVAEALELVQLGGLGGRKPDQLSGGQRQRVALARALVKRPRVLLLDEPLSALDAKLR
EQMRTELCTLQEKVGITFIMVTHDQDEALALASRCAVMSKGLLQQVATPSDLYEFPNSRF
VADFIGQVNLFEGVLAVDEPSHAVIKSPDLPVDIFLDHGVTGPRGGTVWAAIRPEKIELH
KKADDTPPNLGDAPKGTNAVEGVIKHEAYLGGSSTYEVEIAGGRRVKVQRSNLTRWDQED
FKLGETVWLCWHACSPAVLLS