Protein Info for CCNA_03234 in Caulobacter crescentus NA1000

Annotation: glutamine amidotransferase, class I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07722: Peptidase_C26
  • amino acids 4 to 222 (219 residues), 190.5 bits, E=3.5e-60
• PF00117: GATase
  • amino acids 83 to 235 (153 residues), 52.9 bits, E=3.9e-18

Best Hits

KEGG orthology group: K07010, putative glutamine amidotransferase (inferred from 100% identity to ccs:CCNA_03234)

Predicted SEED Role

"Gamma-glutamyl-GABA hydrolase (EC 3.5.1.94)" (EC 3.5.1.94)

MetaCyc Pathways

• superpathway of ornithine degradation (5/8 steps found)
• putrescine degradation II (2/4 steps found)
• superpathway of L-arginine and L-ornithine degradation (7/13 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (5/11 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.94

Sequence Analysis Tools

See A0A0H3CCN4 at UniProt or InterPro

Protein Sequence (249 amino acids)

>CCNA_03234 glutamine amidotransferase, class I (Caulobacter crescentus NA1000)
MTRPVAGIICCTRTVGVEPAQAVMSRYVDATMAYGDVAALLIPSLPGRMRAAEVAGRLDG
LMLTGSPSNLDPALYGEEIGDAPGPFDAARDGMTADLIKAMLDLGKPVFGICRGFQEINV
AFGGTLRRDTSSSSDLIDHHAPEDVSFEAMFDHVHAVKLMRGGVLERAFGVQAAVVNSVH
YQGVDRLGEGLSVEALSEDDLVEAFSATVNGAPVLAVQWHPEWKPAQNRQSQIFFEVFGR
ALRGAPLVA