Protein Info for CCNA_03222 in Caulobacter crescentus NA1000

Annotation: ring hydroxylating dioxygenase, alpha-subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 PF00355: Rieske" amino acids 61 to 146 (86 residues), 80.2 bits, see alignment E=8.6e-27 PF00848: Ring_hydroxyl_A" amino acids 196 to 392 (197 residues), 136.4 bits, see alignment E=1.4e-43

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_03222)

Predicted SEED Role

"Choline monooxygenase, chloroplast precursor (EC 1.14.15.7)" (EC 1.14.15.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.15.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CB50 at UniProt or InterPro

Protein Sequence (404 amino acids)

>CCNA_03222 ring hydroxylating dioxygenase, alpha-subunit (Caulobacter crescentus NA1000)
MLGASQPYDLGPGIRRGSRGKGGAMTQIPNHDPLSDWGLPGWIYTSERFFKEEQDKVFRP
SWQIVCHLNDIPKAGDFHTFDFIGESLVVVRSKDGGVRAFANVCRHRGARLLDGPVGRCG
GRIVCPYHAWTYDLEGRLIGVPMRDDYPALDMAKEGLATIEVEVWRGFVFVRLEGDGPSV
ATMMAPYEDEVAHYRFEELQPFGRVTLRPRAVNWKNISDNYSDGLHIPVAHPGLTRLFGK
GYGVEAEAYVDKMWGQLIDEPSESPSERLYQDILPDVAHLPGDRKRLWTYFKLWPNFAFD
IYPDQVDFMQFIPISAEQTMIREIAYALPDDRREMKAARYLNWRINRQVNTEDTELVARV
QQGMASRTFTAGPLATSEVSLRSFGRKMRALIPESRMPRPPEGW