Protein Info for CCNA_03218 in Caulobacter crescentus NA1000

Annotation: periplasmic multidrug efflux lipoprotein precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 40 to 350 (311 residues), 172.3 bits, see alignment E=6.6e-55 PF16576: HlyD_D23" amino acids 56 to 266 (211 residues), 61.3 bits, see alignment E=1.3e-20 PF13533: Biotin_lipoyl_2" amino acids 68 to 112 (45 residues), 34.1 bits, see alignment 2.8e-12 PF13437: HlyD_3" amino acids 162 to 263 (102 residues), 70.1 bits, see alignment E=3.7e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_03218)

Predicted SEED Role

"Membrane fusion protein of RND family multidrug efflux pump" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CCK1 at UniProt or InterPro

Protein Sequence (358 amino acids)

>CCNA_03218 periplasmic multidrug efflux lipoprotein precursor (Caulobacter crescentus NA1000)
MEQLMWRTPLPPLAALLLAATLSACGGKTETDAPAPPTPVEAARVAAPDAAGAVTGAGAL
ERRREMALSFRIPGVLTTMKIEAGDSVRAGQLIAAIDPAGVDARQQQTQADLERVRRDLE
RDKVLFEKGYVSRQRIDDRTSALKAAQAAYDAAHFDRRWANLVSPVSGVVLERRAQAGEV
VGAGQVVARVADLTSPLVLRLPLAARDAARIRVGDPATVKVDEIGETALNGRVTRVGEAA
DARTGAVLVEIELSAPPSTLRSGQVAHATLNVRAAPGVTTTYARVPAEAVLEANGQRAFV
FRVDGGKARRTAVGFGGFDGDDALVSGLPNGAQVITAGAGFVSDGEAVAVVDPTRLGR