Protein Info for CCNA_03191 in Caulobacter crescentus NA1000

Annotation: PAS-family GGDEF/EAL family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 748 PF00989: PAS" amino acids 154 to 265 (112 residues), 26.6 bits, see alignment E=1e-09 TIGR00229: PAS domain S-box protein" amino acids 156 to 274 (119 residues), 51.9 bits, see alignment E=8.4e-18 PF08448: PAS_4" amino acids 158 to 270 (113 residues), 59.2 bits, see alignment E=9.2e-20 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 276 to 438 (163 residues), 132 bits, see alignment E=1.7e-42 PF00990: GGDEF" amino acids 279 to 434 (156 residues), 158.3 bits, see alignment E=3e-50 PF00563: EAL" amino acids 457 to 687 (231 residues), 260.3 bits, see alignment E=3e-81

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_3094)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CCH8 at UniProt or InterPro

Protein Sequence (748 amino acids)

>CCNA_03191 PAS-family GGDEF/EAL family protein (Caulobacter crescentus NA1000)
MFTLRDTVSFLEPAREDHLGKTLYDRFREEPDTLIIPVLDADDRPIGLVERNAFFLRMAA
EYGRALYANRPISTLMDREPLVVDAEMALADFTTDSLSYRASDLLRGFIVTEAGRYLGVG
TVLALLQAANETNRRGVEALALAKAEVERAQTFMTGIVEAMPAMVFVKRADDHSYVLLNR
AGEKTLGFKRDEVIGKTDADIHDAELAALYRERDRAVLDSGEVRVIEEDHVPRKDGGMAI
LRTKKIALLNAEGRAEYLLGVSEDIAERKRAEAQIARLAHYDPLTDLPNRVLFQKSLGEA
LARRSRKGDALAVHFVDLDRFKTVNDTLGHPLGDALLKIAAERLRGCVREGDTVARLGGD
EFAIVQTGLDDSNGATRLAARIVEAMAAPFDLQGHHVVIGASVGVSLAPTDGDDADELLK
KADMALYRAKADGRGAYHFFERAMDEQLQARRALELDLRRALQAGEFELFYQPLYHLGDE
RVTGCEALLRWRHPERGMVSPADFIPLAEEIGLIVQLGEWVLRRACAEAANWPEHVRLAV
NLSPAQFRDRGLVRTVVSALAASGLPAQRLELEITESVLLQDSQANMTMLHDLKALGVRI
SMDDFGTGYSSLSYLRSFPFDKIKIDQTFVRDILHDSDAMAIIKAVLDLGASMGVVTTAE
GVETQAQLDALRQQGCAEIQGYFISRPAPASEIAKMLGVEGRADLGAPSVLSPIGANPPP
PQAGQEVRTAPSSPVAERTGEGSRGQAA