Protein Info for CCNA_03137 in Caulobacter crescentus NA1000

Annotation: endo-1,4-beta-xylanase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF00331: Glyco_hydro_10" amino acids 40 to 348 (309 residues), 265.1 bits, see alignment E=4.3e-83

Best Hits

KEGG orthology group: K01181, endo-1,4-beta-xylanase [EC: 3.2.1.8] (inferred from 100% identity to ccs:CCNA_03137)

Predicted SEED Role

"Endo-1,4-beta-xylanase A precursor (EC 3.2.1.8)" in subsystem D-Galacturonate and D-Glucuronate Utilization or Xylose utilization (EC 3.2.1.8)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.8

Use Curated BLAST to search for 3.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CBI1 at UniProt or InterPro

Protein Sequence (352 amino acids)

>CCNA_03137 endo-1,4-beta-xylanase (Caulobacter crescentus NA1000)
MSRLTRRSAIASALALSACAREVQSQPVADTPLKSIASTPVGACLQRHQLDDPAFAALLT
RHYSQITAEWEMKMEYILQDDGRFRFDRPDAIADFARRHGLRLHGHALIWYSQVMPAFRA
LDGQGKRFADAYRNYILAVAGRYRGLAASWDVINEAVDDNGVDLRRSAWTDNLGVDEHMI
LAFHHAKEADPDAVLFINDYNLENNPTKRATFLRMVERLLKAGAPIGGIGTQSHLGLDFT
PPGMCRIALRDLASLGLPIHVSELDISFGDKPETAPLPKLLSRQADLARELAQAYMDLPR
AQRFAFTVWGVRDRDSWLRGANGERPWEHPLPLDDAGQPKPMFQALAEVLSG